DPCstruct | MC23198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 86 ± 4 aa |
| Standard deviation of domain lengths | 3.54 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 84.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L8M0L0 | 183-269 | TKGRVSVILDQALEEGYQIGYTNEVQKGMSGGALLTIQGLLVGVNGKHAYPLWEAPDYYEDQSQPCEPLQELIIRSSLAIPLKKVTN |
| K7VVV8 | 2-85 | LVLEKALERGYQIGYTNKLEKGMSGGPLLNENGQLIGVNGMHAYPLWDVPSVFIDGTPADEKLHQQIVRLSRLALKIVVMALGL |
| A0A853MBF5 | 4-87 | None |
| T2JUD5 | 1-86 | None |
| A0A2T1C253 | 286-372 | None |
| A0A856MCP7 | 270-354 | None |
| A0A1L9QXT0 | 162-246 | None |
| A0A6M0A0Z6 | 187-266 | None |
| A0A139XFW3 | 34-123 | None |
| A0A2T1G568 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.