DPCstruct | MC2319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 359 ± 39 aa |
| Standard deviation of domain lengths | 39.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02663 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6QKR5 | 160-498 | RVLAEQTAKFALKTLGNKGDFMVLTNAGYAIIDNKSTSPCLDGITSVIGCTSGNGNLLEIHTADSKPLWFFFYEKNSGNGIFIEMDG… |
| A0A223ZDI3 | 125-450 | TDAYKLGREITKKADQILNFTRTGEVLVITTAGTAYYKNQTTEDALEGILNQARGIVSYGKGNLLMLRKTRLDPLDFAFIVRKGNDL… |
| A0A3R7F4C4 | 241-623 | None |
| A0A520K724 | 434-853 | None |
| A0A520K6P1 | 357-680 | None |
| A0A3A5HGF4 | 268-705 | None |
| A0A1H7LX90 | 69-422 | None |
| O26999 | 25-367 | None |
| A0A259UW31 | 7-325 | None |
| A0A368TGH9 | 29-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.