DPCstruct | MC23189
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Standard deviation of domain lengths | 7.99 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C1WSG8 | 34-108 | QPIPMSVRTVMAKAGMKSADPVLIRIFKAENELEIWKKGADGRFSLLKTWPICSWSGELGRKRREGDRQSPEGFY |
| A0A351GR04 | 8-79 | NVLIANYKCLRVGQPIFIRIFKEERMLEIWVKSDSNEFKLFKDYEICNFSGDLGPKLKEGDRQSPEGFYSVG |
| A0A7C7U9X7 | 48-129 | None |
| A0A7W6J9I2 | 1-60 | None |
| A0A2N9XPP8 | 87-163 | None |
| A0A1E2RYP1 | 52-134 | None |
| A0A1C4CPV7 | 18-96 | None |
| G5LU37 | 1-70 | None |
| A0A2P7P3P7 | 6-72 | None |
| A0A2I0QZ78 | 28-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.