DPCstruct | MC23188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 133 ± 12 aa |
| Standard deviation of domain lengths | 11.84 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A0C971 | 228-372 | DAPVREAGLFGIFGGHVNVTDGRWVYLRAPARPGNQPLSEYTLMPTLMRGRMPVEVLREATLAPPFKFTKGVSPLRVAGTAYTDPHA… |
| A0A314VUV3 | 2-134 | GGQVNVTDGQYVYMRATTTEDNKPLYDYTLMPTHMKNRFSPRELQEWEKVEGFGFMKGCKVMQIPTRSFPIFSEKDNPLGRGRTATL… |
| A0A7C3N9L0 | 1-116 | None |
| A0A0D9SHC5 | 464-604 | None |
| A0A4R6WVC0 | 166-309 | None |
| A0A6N9C180 | 2-132 | None |
| R5TBB7 | 11-147 | None |
| A0A379UNC1 | 1-115 | None |
| A0A0Q9MD49 | 1-116 | None |
| A0A6D0EH11 | 2-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.