DPCstruct | MC23186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 68 ± 10 aa |
| Standard deviation of domain lengths | 9.62 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 32.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S0TBJ7 | 1-66 | MHKSYVIEVGDDQAGLIIREDGERDYLFHAARNEYSALEGRRFANALLAERAAIAHASSRRRRRAA |
| A0A519Y6E5 | 38-101 | APPRIIEIGEITAGIAVPEPGGVRFFASSRDFAPLDGTVYRSVEQAARAARDRFRNRTRPGTGA |
| A0A512IL89 | 4-80 | None |
| A0A327K0P6 | 1-55 | None |
| A0A7W5TS10 | 1-65 | None |
| A0A1M3NTB3 | 88-165 | None |
| A0A7X0EGM4 | 20-86 | None |
| A0A560HH44 | 1-85 | None |
| A0A679IR09 | 38-101 | None |
| A0A0Q7PRJ3 | 11-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.