DPCstruct | MC23185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 112 ± 16 aa |
| Standard deviation of domain lengths | 15.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 39.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183BUQ3 | 248-358 | LAQWLHIPRGDGRPKVCDCRLSNVAGLEALKAAFLNATTSVGFLIVAELWGVSVVDVEPFELQNRRTRERLTLRHVNNCWLLDICMI… |
| A0A183C9C9 | 1-93 | MEEVTEWLHTPRGDGHPKVLQCDFCPTELEGLIRALPLRPPFELENNLTGERLKFRRLDVDKWRLVRCPIERDEAEWAAWEAEAAGN… |
| A0A183C2I6 | 7-98 | None |
| A0A183C1A3 | 57-145 | None |
| A0A183C0C7 | 382-497 | None |
| A0A183BZS4 | 354-470 | None |
| A0A183BSM3 | 193-296 | None |
| A0A183BVJ5 | 2-109 | None |
| A0A183BTC7 | 360-489 | None |
| A0A183C2S6 | 208-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.