DPCstruct | MC23182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 98 ± 10 aa |
| Standard deviation of domain lengths | 9.59 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 51.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183BIK4 | 103-198 | GQQNALKVVKLEQYQKEQQPNIVHLQKTFAVLREIGLIRQQNRWDSAACHKDLTLSEPDRLIVQHNGENSGWWRAVRAEKPMTENFY… |
| A0A183CJC3 | 69-175 | MNQLKAELIAKMEECQKQQNIDAKMEECQKQLQQNIADLQKTVAVLSEKIGPINRWDSAACNPSLALIGPEQLIVQRNGDEEGWSSV… |
| A0A183CRE9 | 46-131 | None |
| A0A183C8M5 | 275-393 | None |
| A0A183C7G0 | 1-103 | None |
| A0A183C0D2 | 201-292 | None |
| A0A183CR03 | 94-200 | None |
| A0A183C7F8 | 147-249 | None |
| A0A183CJQ1 | 1-94 | None |
| A0A183CI78 | 121-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.