DPCstruct | MC23181
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 154 ± 8 aa |
| Standard deviation of domain lengths | 8.28 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 74.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04046 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183BY87 | 6-157 | GSRFHEQCQGPQPGVISEQLRDALGIGLRVLPPWIYRMRRLGFLNGYPPAYRKRATEQLTVKFHMEDEPTSTVGGRRKRKHAETTGA… |
| A0A6J8CBA0 | 303-454 | TGSRYHRDDDPRFATFRPGQISDKLREALGLSPQQIPLYVYRMRMLGYPPGWLEEAKKQGSGLMLFDKHGKEVDITGQSMEDGEVNE… |
| A0A5S6QHA1 | 279-422 | None |
| F6W6D7 | 244-399 | None |
| A0A815Y6N0 | 234-398 | None |
| A0A0K0DWD4 | 118-269 | None |
| A0A4X1U8M6 | 356-499 | None |
| E4X473 | 1-170 | None |
| A0A6V7Y840 | 1-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.