DPCstruct | MC23180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 260 ± 51 aa |
| Standard deviation of domain lengths | 50.93 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2M1N8 | 213-476 | DKRYIIRYQTITFLVSLLQEGYLLTKNTLLFCLLSTIIDKYETIQEIGKYGLSTLIFEKKKNIFLESFTEAVFVFNHYFPSDNQGQQ… |
| A0A183BS60 | 584-863 | WDSSILIRRQTLLLLTNLIKEQYLKWEGPIIYRFVTTLLDAEQCIQEYANFCLTDILLPQFRERMFFHHFLECMFNFNGVRHASWIF… |
| A0A0D9Y036 | 620-910 | None |
| A0A7S4A5Q6 | 3-255 | None |
| A0A0D8XFS1 | 64-333 | None |
| T1FR75 | 2-229 | None |
| A0A086K6M9 | 146-482 | None |
| E4XKX1 | 13-322 | None |
| J9F5G5 | 2-243 | None |
| A0A183FQ21 | 2-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.