DPCstruct | MC2318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 180 ± 18 aa |
| Standard deviation of domain lengths | 18.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B8E937 | 30-191 | ADAQQPLRGANQLPSPPEPEHITVVELPLPPVTPSDATGSCTRAINTRGTGCTGKVTGLSSGNFLPDNKHVVASIIFTGAPAAPDPR… |
| W3X136 | 1-186 | MLPNIQLTLIQAAATLLAVTAQPLSQQLSVSGGLAEIPSPPSPEPIEISEVPMPPVVQGNASCSTSLNHRGTGCISQEPGLTGVSFM… |
| A0A366PVC2 | 390-555 | None |
| A0A0U4Z377 | 500-676 | None |
| A0A815X1F7 | 1-169 | None |
| A0A4Q7K7K0 | 1-176 | None |
| A0A2X3KZG2 | 1-224 | None |
| A0A830IMJ2 | 4-207 | None |
| X0I2U9 | 1-182 | None |
| A0A2K0WVP9 | 6-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.