DPCstruct | MC23173
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 150 ± 17 aa |
| Standard deviation of domain lengths | 17.09 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 44.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I5SRV8 | 207-334 | GHGNMQCSACHGSTHAIYPSAKAEDNIQSIQAQGHAGTIGECTACHTTVPFTSNKGPHGMHTVGQAWVDGHGDIAEDGGASSCTACH… |
| A0A7R6WB73 | 227-379 | FERLTAIVPLFAENDHVLYRNGLDKHLELGCDSCHGRGSDASANVATIQLQGHAGTISECITCHQVDSFPNGTLQGPHGMHPVNEPS… |
| A0A831WBD0 | 69-198 | None |
| A0A090AIL8 | 718-901 | None |
| A0A836S381 | 304-451 | None |
| J1FBA4 | 435-558 | None |
| A0A6L3EL10 | 147-317 | None |
| A0A7V7MKY2 | 425-572 | None |
| A0A831RHG2 | 686-819 | None |
| A0A0C2V9M5 | 341-501 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.