DPCstruct | MC23171
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 234 ± 27 aa |
| Standard deviation of domain lengths | 26.64 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S2F893 | 93-344 | FGKWIISPNVTINYAAITAHYTAYKTNGYDYYDSHADIDLTNAIINSFSDTDMQQWQAFKDAANELTGVTDWVVDAANNQIVYTVTP… |
| N8X938 | 49-319 | APVASFGQWVVNGYASEGASTVLNANRIIGGVSTESKALITPNVSQVSKILRAGLGGAALTFAVNELLDGIDWVMDPENNSVKFKTE… |
| A0A833PBK8 | 25-244 | None |
| A0A6A1RUU7 | 17-229 | None |
| L2F5W2 | 18-245 | None |
| A0A1T0CDH4 | 28-250 | None |
| A0A811G777 | 1-208 | None |
| A0A0L7QK21 | 84-299 | None |
| R9AZ67 | 182-396 | None |
| N8YNT5 | 21-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.