DPCstruct | MC23167
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 212 ± 34 aa |
| Standard deviation of domain lengths | 33.97 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.61 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0291- PF15935 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M4YST7 | 36-261 | VQANWCITSVEHSDHIVVTHYKTTRKLQIQGKPLSTYRHLIYLLSELLDMAGLENVLNRTEDGKNTEIVRTEVALDYLKMKLPKSID… |
| A0A412BLB1 | 10-173 | NNTYNVSIDKDEVCSEFQFYMPNSFDKFSSKMEKALLQAVYNLKLNGNMFDGTFLAHPAMRVVEAHLKILLVKYEIIPDAKYIKDNG… |
| A0A7Y9HWN6 | 33-222 | None |
| A0A1V5CX27 | 73-368 | None |
| A0A1I5HND1 | 363-528 | None |
| A0A484GDR0 | 4-183 | None |
| O69417 | 17-207 | None |
| A0A559NM41 | 128-344 | None |
| A0A075S089 | 65-281 | None |
| A0A656Y6G1 | 11-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.