DPCstruct | MC23164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 74 ± 6 aa |
| Standard deviation of domain lengths | 5.73 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497QVG1 | 2-71 | SERKITVICPVCGRSGRIPVPVDVIQKKETGATSVFIPAGMICEDAFYAYVDKNFDVRDYLVLEFSLMDE |
| A0A523RGH8 | 6-78 | TNRYVQVICPVCKSKDVIQIPKSVINNATQLTTISVPKGKICPHHFQLFLDKNFAIRGYQKVDFQLKHDKNDK |
| A0A842R0A0 | 1-63 | None |
| A0A842S8D9 | 16-85 | None |
| A0A524FJ76 | 10-88 | None |
| A0A524NSR8 | 72-138 | None |
| A0A5B9D888 | 2-74 | None |
| A0A2J4G956 | 1-74 | None |
| A0A1Q9MSV3 | 1-71 | None |
| A0A842QZC8 | 11-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.