DPCstruct | MC23162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 353 ± 63 aa |
| Standard deviation of domain lengths | 62.77 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 69.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 23.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4D5N0 | 51-439 | TVEPDNLDCDRNAWPKTLEDLDANIGKVPIHCRGMALMDILTKELAGAVDKYREVSSSDDYKQRFEWYADWVKDSIEPRLMKFTALK… |
| A0A6G1H6G5 | 719-1105 | DWAVDLQSFESDVHYDNPGDVDEPPPPTCDGTYSNLEDIEKDKDKIPVECMAAYLLDALAALLDKGIKDYDDILKTDYDEKFGYFAD… |
| A0A066XJF4 | 809-1208 | None |
| A0A0S7DH97 | 42-286 | None |
| A0A2S4L5Q7 | 244-660 | None |
| A0A2T4C3W9 | 583-973 | None |
| A0A6A5SB87 | 5-338 | None |
| A0A0G4KNV0 | 170-622 | None |
| A0A2T4BKV8 | 202-538 | None |
| A0A194X730 | 757-1145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.