DPCstruct | MC23161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 74 ± 7 aa |
| Standard deviation of domain lengths | 6.58 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 59.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1H571 | 26-101 | DYYGVIFDHLVPEGEEDPETLQINIFEIEADGGEYAKTVMTAFNLDLEFFEGKRILAVPRCCQTRKGTTDRRRING |
| A0A135SBT9 | 293-363 | PVDDADPEVLQLNIIEVESDHGKNANEYMRFPVDALEYAGKKVLTVPRCCQKRKGTTDRARVNNEVLYRDG |
| A0A2J6TDU8 | 67-135 | None |
| A0A179IA51 | 113-187 | None |
| A0A2H4S8U7 | 19-84 | None |
| A0A395GZ91 | 5-70 | None |
| A0A1J7J8B5 | 1-80 | None |
| A0A1B8FJQ4 | 143-215 | None |
| A0A1V6SIV8 | 1-70 | None |
| A0A2T3B2U4 | 11-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.