DPCstruct | MC2316
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 81 ± 4 aa |
| Standard deviation of domain lengths | 3.94 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 66.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 75.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06384 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W3H5U2 | 20-100 | MNRDSASGKTPEEMYIQQKVRVLLMLRKMGSNLTPSEEAFLRTYSGVVSSQLSQLPQHPIDQGAEDVVMAFSRQEAEDRRQ |
| A0A3Q3RA88 | 1-78 | MNREEAPGKSPEDMYIQQKVRVLLMLKKMGSNLTPSEEAFLRNYAGVVHSQMSQLPQHNIDQGKTVTCPRAHTHTHTH |
| A0A4W4HGZ0 | 32-111 | None |
| A0A7M4E4I8 | 1-84 | None |
| S9XB19 | 39-122 | None |
| A0A7J8K6M5 | 114-193 | None |
| A0A5F7ZYX0 | 147-233 | None |
| A0A6A1Q731 | 1-80 | None |
| A0A5C6MT11 | 1-73 | None |
| A0A3N0YMK6 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.