DPCstruct | MC23153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 146 ± 37 aa |
| Standard deviation of domain lengths | 36.72 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 89.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L4AL98 | 61-179 | PLASTFMLSTKAGMEAYVEPVIEGSTYRFMVKVGKPKDTEAVKKGTKLSQGSFRCLMSNTPFRYSYIDDEANAWRMGVRLMAVVAEG… |
| A0A7C5SYH6 | 217-347 | PLIRQFWLAKKEKKKISLYPFVYNKGVEFAIVKKEGNQWRVLESSVEGFEPKVPENFDPEKGTVARAKAVCLVCGSTIEDDDVRRLF… |
| H1D2Q7 | 215-361 | None |
| A0A4V1ERN6 | 131-338 | None |
| A0A7U7GAS5 | 1-213 | None |
| A0A011NP66 | 7-102 | None |
| A0A2S2C5R2 | 1-123 | None |
| O30323 | 2-101 | None |
| A0A7G8E7P1 | 7-99 | None |
| A0A329PB58 | 27-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.