DPCstruct | MC23151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 143 ± 32 aa |
| Standard deviation of domain lengths | 32.43 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 86.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A679K216 | 2-106 | ITLLSFAYKKGVPLVDHVFDCRTIPNPHHVPTLRDLTGRDEPVQHYVTLSAATDEITTQAARRIMEGAEHLAFGCYGGRHRSVAVAE… |
| A0A525D5X2 | 317-452 | TQNVASDGEEKRVSLVVYSFGFKHGVPVDANMVWDVRFLPNPYWQEELRPMSGQEQPVADFVIESEQGQKFLELLKPMLEFLIDSNS… |
| A0A2N3YU27 | 133-286 | None |
| A0A1R3UNP2 | 4-125 | None |
| A0A221W5A4 | 22-132 | None |
| A0A1G7PV30 | 314-447 | None |
| A0A388Q3D4 | 240-369 | None |
| A0A6A6YXX8 | 144-282 | None |
| A0A2V1CXV3 | 25-256 | None |
| A0A6G0X8G1 | 67-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.