DPCstruct | MC2315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 140 ± 23 aa |
| Standard deviation of domain lengths | 23.39 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0526 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B3QQV9 | 21-136 | KLVKKYNGLEIKLKEPKGYAVRITDLNGTVYWGRDEMLESWSELYLPESTEMVVIGAIDNFPSLAEGLQLIVLVDSQGKVYFYENEV… |
| A0A3Q3QTE3 | 86-234 | VKGLDSDFVTTHRHKIFRLRCPTGARLRIAGLEDTMYRDDDYEVKSWGAFYLPDEVKMQVFGVVEGTSCPYDQLVLMTCEDGRVYAF… |
| A0A126LB22 | 799-931 | None |
| A0A6F9CPJ5 | 6-142 | None |
| A0A6P7NXH0 | 171-283 | None |
| A0A3Q3LFA1 | 66-194 | None |
| A0A674IWP9 | 2-123 | None |
| A0A6P4YG69 | 126-247 | None |
| A0A673XR71 | 17-196 | None |
| A0A6J2QLX1 | 212-368 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.