DPCstruct | MC23144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 166 ± 28 aa |
| Standard deviation of domain lengths | 27.84 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0SKU0 | 4-164 | TFMQQHNLQKPKEVWLQNISEILDTPHEEVGNNQKIFSIDREDYKQRMIDCFLIIWQAGENDEFIITSNGFGIFEGVSGNMFGAFPF… |
| A0A2T4C446 | 138-326 | YRGEQYHRRYNLDSMQDYHEDDKELLQDYMTRHGFTRPIDVWLRSLETIVDLDMDAKESWKKSIFKSVYFPIADAFVSHIGGMYMAI… |
| A0A0I9XD70 | 7-136 | None |
| A0A0J9WB50 | 1-124 | None |
| A0A2T6ZX11 | 427-610 | None |
| U4LKG0 | 236-414 | None |
| X0IVF9 | 7-136 | None |
| L8GCI2 | 61-252 | None |
| A0A3N4M3V8 | 220-438 | None |
| W9HG98 | 11-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.