DPCstruct | MC23143
Metacluster Properties and Pfam Annotations
| Number of structural domains | 908 |
|---|---|
| Mean domain length (aa) | 175 ± 28 aa |
| Standard deviation of domain lengths | 27.52 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 14.93 |
| Pfam Score | 97.14 |
| Assigned Pfam label(s) | CL0023- CL0378- CL0016- CL0149- CL0091 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1IXE5 | 217-404 | ARPLGLVEYSFDTDGTEYGGRADMNSLLTLETSHTLPSKEDFRRRIALAWASLRLQHPMLTSRTVENAETLGRSFVVDVCESAEEVV… |
| E3RZQ1 | 9-171 | ILPVTHSQKIYLCRGLDDPRVAFNHFYVDIGPQLDLELLRDSCRKLVDHFSILRTKFVPHKQEWFQIVLRTLELPFSVFDVDQSMDE… |
| A0A0F7SBP9 | 160-315 | None |
| A0A194ULN6 | 4-154 | None |
| A0A2P9IBG7 | 467-641 | None |
| A0A1K2CK94 | 35-199 | None |
| A0A1D9FLV2 | 322-566 | None |
| A0A5E4ESX7 | 38-235 | None |
| F6H6F0 | 163-345 | None |
| A0A2G7GLA6 | 453-635 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.