DPCstruct | MC23140
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 184 ± 28 aa |
| Standard deviation of domain lengths | 28.27 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5U5H0 | 228-421 | HVRGLIPFYQENNKLRIERRIGICENLLPLGWFGIDRREGARYKGEYRALDILTTIVPWFEEASTLLACGLPSHVYTLIVDGRTPEG… |
| E3RHI2 | 1-188 | MRIERRVDMWRNLLPGGATPFQTYAAQSYRKDELEAKYVTNAVGDWIIEANALSSLGMPTDVFSLVLDGGETAERTSEVFKTVHRDC… |
| A0A2T2P7I7 | 213-401 | None |
| A0A135SMI7 | 291-486 | None |
| A0A4R8TKZ4 | 10-203 | None |
| A0A1L7W9F2 | 310-493 | None |
| I1S3A3 | 143-343 | None |
| A0A1B7XZW0 | 321-531 | None |
| A0A5M9LL75 | 2-219 | None |
| A0A135V339 | 258-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.