DPCstruct | MC2314
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 147 ± 18 aa |
| Standard deviation of domain lengths | 17.79 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 54.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287AQJ5 | 27-168 | QGSCAADLYRHPQLDADIEAVKEIYSENSVFIREYGTIDDVDIDLHINISFLDEEVSTAWKVLRTEPIVLRLRFSLSQYLDGPEPSI… |
| A0A401PAX1 | 103-230 | QGNYDGELHKHPQLEADLAAVREIYGSGAVSLREYGAIDDVDIDLHIDVSFLDEEIAIAWDVIRTEPVIVRLHCSLTQYLNGPVPTV… |
| A0A673A505 | 1-140 | None |
| A0A3B3YUG9 | 1-182 | None |
| A0A498MUH6 | 3-159 | None |
| A0A1X7SX53 | 7-156 | None |
| A0A553MRL2 | 23-146 | None |
| A0A553QKC6 | 25-166 | None |
| A0A4W5KYF5 | 2-139 | None |
| A0A6A4TDL9 | 2-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.