DPCstruct | MC23139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 214 ± 37 aa |
| Standard deviation of domain lengths | 37.37 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A395MND2 | 27-211 | QGEDDVATSVAGDRVYVDAPGRKWFRHVWLWDSDYTDDTTTTFEPKTHGPGVSKQSPLPGHSELQPHSMAMEMLEIGLVLADNPKKF… |
| A0A6H0Y602 | 3-203 | VEVDGRQTFRISYLKCNVDKLTSAKKSINKPYDLSIDGPKATRDAAITSKTPLTGELQYRDGMMAYLEVGLVLGDDPDKYTLSAKSK… |
| A0A319ENQ8 | 14-194 | None |
| A0A6A6UI66 | 26-228 | None |
| A0A6A6UFT0 | 15-206 | None |
| A0A6A6TXA9 | 30-265 | None |
| A0A2H3SIR7 | 1-150 | None |
| A0A6A6Q3D6 | 2-208 | None |
| A0A0I9XQP6 | 7-241 | None |
| A0A6A6VAG4 | 12-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.