DPCstruct | MC23138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 114 |
|---|---|
| Mean domain length (aa) | 343 ± 72 aa |
| Standard deviation of domain lengths | 71.62 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 72.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 19.38 |
| Pfam Score | 85.40 |
| Assigned Pfam label(s) | CL0680- PF04858- CL0584 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453MT62 | 2-181 | QRKARDDFFTMLEECKDLTSSLRWSKAITMFGHDERFNAVERPKEREDLFENYLVELQKKEKAKAAEEHKRRIAEYREFLESCDFIK… |
| A0A6H0Y5P7 | 24-342 | WEKPEDFDEQASAASPQAATANGTNAGAWKEAVNQADGRTYYYNTVTNATTWEKPAGFVQSQIPSTAVALNGDSHRRLIQRDSFRDA… |
| A0A7J6PN35 | 1-227 | None |
| U6KT50 | 17-368 | None |
| G4ZMS8 | 145-512 | None |
| A0A815UJF6 | 264-590 | None |
| A0A4U0VJG5 | 80-573 | None |
| A0A0V0QTW6 | 273-645 | None |
| B0E9S9 | 45-362 | None |
| A0A0D8XRL4 | 10-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.