DPCstruct | MC23134
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 177 ± 33 aa |
| Standard deviation of domain lengths | 32.86 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J2WMU0 | 1-169 | MNLFDLLKLWEPTFSPEKAKVHLARYNGEDHPLDVFIQGGFDKWQSRQSNRNFKLPYVVSLIQAGSPTRWLFAGLFRTMECVERVGP… |
| A3JLV0 | 117-312 | MPILLQDIWPIENLGEYKIHFARWNQDSQPLEVFARDRREWQAWQEYRPGRDDFNRPLIFSLIQFYHEQDTWLFGGVYRVLERHADR… |
| A0A0M4NE60 | 209-421 | None |
| R4KAQ8 | 6-133 | None |
| Q1M9B9 | 2-211 | None |
| A0A5M9ZXK0 | 47-268 | None |
| A0A1J5F9X4 | 106-318 | None |
| A0A1Y5Q8Y2 | 172-372 | None |
| A0A839GN09 | 269-464 | None |
| A0A1V3P540 | 2-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.