DPCstruct | MC23133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 201 ± 25 aa |
| Standard deviation of domain lengths | 24.62 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 14.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0291 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G6WVY5 | 9-195 | LDDRIRTASELLKRARIFFDVWWLYEGQATRSGILDAMNEYPDYFTFDSHAHFVAHIVHMAMLYEGGGDTTNLRALRKELGARLDAK… |
| A0A2R5G1V1 | 5-214 | SEELGKLLDGIANNLVHASIHNRLHTNLCKASEEYNYEMNHSPVFWQLTINAHATTTILMLCRVYDTHKDSLNLKKLLNIISANSKL… |
| A0A7C2IYR4 | 15-175 | None |
| A0A263HIQ6 | 133-335 | None |
| A0A7C4UVG9 | 1-183 | None |
| A0A662H3N0 | 31-182 | None |
| A0A139BTZ3 | 1-175 | None |
| A0A4R1YLA4 | 10-203 | None |
| A0A5R8QLU2 | 35-253 | None |
| A0A1F9VQB3 | 199-403 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.