DPCstruct | MC23129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 82 ± 7 aa |
| Standard deviation of domain lengths | 7.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177M8V5 | 45-128 | RADRVRALYGLNGAGITIGVISDSYNCLRGATAGQQQGELPAEVVVLREADCQSEHAIDEGRAMLEVIHDLAPNAKLVFHAMGN |
| A0A7R8B3M4 | 217-298 | RANYVVNSLGYTGNGVKVGVLSDSASAARVAALIASGDLPANTVVLPGQEGPSTGSDEGTAMMEIISDMAPGAQLYFATAFT |
| A0A3N9MR44 | 185-260 | None |
| A0A0P6VZ26 | 103-187 | None |
| A0A847V9E2 | 165-242 | None |
| A0A843MC90 | 1-73 | None |
| A0A1V5ZG50 | 271-342 | None |
| A0A7J4PLH7 | 203-276 | None |
| A0A383VEP9 | 96-173 | None |
| A0A3D5CD08 | 199-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.