DPCstruct | MC23126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 89 ± 12 aa |
| Standard deviation of domain lengths | 11.77 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 24.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14239 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R5FGI5 | 3-105 | LALRQGSNWRDTEQKILLRRIDVAATICPIIHNYMSKVFILNANQQPLYPVRISRARLLLSQGKATVFQRYPFTIILKESLSHLKLE… |
| H2YDP5 | 45-128 | KNQKKNTAHTKPNNFKPFKLYSTRKHPLYDNCKLQAPDGQLLSTCDRKKADWYIEKELADIVTETPFTIRLRFEPAGRPASNRD |
| A0A2N0V5L2 | 1-67 | None |
| A0A415ZKN6 | 18-101 | None |
| A0A2H9L4A3 | 46-147 | None |
| H8GPJ8 | 1-84 | None |
| J9JL49 | 237-321 | None |
| A0A4Y3VUQ8 | 42-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.