DPCstruct | MC23123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 131 ± 18 aa |
| Standard deviation of domain lengths | 17.58 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822ZX88 | 427-554 | MQDGLHQKVHFILSTAPMWDRLELKNNKHLFGEFLEFKGKQDDIQALRNIKRSKVSQLIIQKFSMLGLAHSKLQVLYSPRDFRNDGA… |
| D6PKR7 | 4-147 | EAGFIDLLESTKPGELNPDLVETLEGFNTWDEVHLNGGLLLKGDVFALGLGKNVDEWFAERDTDVEASLIQKRSWLSLFSNNPTEVH… |
| A0A4D9ABC9 | 127-281 | None |
| A0A7J7LE56 | 518-672 | None |
| A0A7J6APB9 | 236-345 | None |
| A0A443P7P6 | 198-325 | None |
| A0A803KSS6 | 93-224 | None |
| A0A2R6X0W0 | 264-401 | None |
| A0A7M3ZUL7 | 29-171 | None |
| A0A498KK73 | 1044-1151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.