DPCstruct | MC23122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 92 ± 13 aa |
| Standard deviation of domain lengths | 12.98 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 39.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X0CU03 | 1-57 | MDEETLLVEACESLASATVMLGDFAGTLEGPSRNTVLGIAQVVMLGELAVSQALDNV |
| A0A560PZF6 | 11-105 | LKDRATAERVLNLYLNPKPPEQSTDPRIDSLFSVTAKADADTLLTSTSETLASVKAMAEDLAFEVEGTRRSVALGIQQLVELCQLLV… |
| A0A3L8CVX9 | 24-116 | None |
| K9NKT2 | 73-167 | None |
| A0A7Z2XD47 | 1-94 | None |
| A0A1H8ISE6 | 4-93 | None |
| A0A6I6QW85 | 1-106 | None |
| J3ESR9 | 9-105 | None |
| A0A524BXY8 | 2-96 | None |
| A0A2T0YZ10 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.