DPCstruct | MC2312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 57 ± 3 aa |
| Standard deviation of domain lengths | 3.24 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 71.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498MIA4 | 1-55 | MSHKEILQVIQRERLKEISGTSPLACLNAMLHTNSRGEEGIFYKVPGRMGVYTLK |
| A0A3Q3KAN8 | 1-57 | MSHKEILQVIQRERLKEISGTSPLACLNAMLHTNSRGEEGIFYKVPGRMGVYTLKVS |
| A0A670ZK65 | 1-57 | None |
| A0A493TU83 | 30-85 | None |
| A0A6I9MMJ9 | 29-86 | None |
| A0A3Q3WCF8 | 1-57 | None |
| F1Q5H5 | 29-95 | None |
| A0A6P8H9T1 | 32-89 | None |
| A0A4W3H0F9 | 26-79 | None |
| A0A4Z2BUZ5 | 29-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.