DPCstruct | MC23118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 65 ± 9 aa |
| Standard deviation of domain lengths | 8.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.81 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 51.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02416 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B0WS77 | 1-64 | MGIGGISVWQLLIILAIVVMLFGTKRLRSLGSDLGSAVKGFRKSMSEDNDSAEKPAAKPDPAEP |
| Q21FP8 | 1-48 | MGLGGISIWQLLIVLVIVLLLFGTKRLKGLGGDLGGAIKGFKKAMSDD |
| A0A2N5YAM0 | 1-61 | None |
| A0A355SNE1 | 1-72 | None |
| A0A1G9DRI3 | 1-60 | None |
| A0A4U0GI94 | 1-77 | None |
| A0A1W9GZM4 | 1-76 | None |
| A0A4R3MYC2 | 1-69 | None |
| A0A833LRM8 | 1-78 | None |
| A0A4R7QIG0 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.