DPCstruct | MC23117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 144 ± 16 aa |
| Standard deviation of domain lengths | 15.55 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.54 |
| Pfam Score | 91.23 |
| Assigned Pfam label(s) | PF17408- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8GNG2 | 1-158 | MNDQPRRFLQRVWDSVRQPPSVTASHAADTLVGLCDSLLSERGEVSGARMAGEAMAAYQELNDAGRGAFFGQLVDHYTADPDAVTRA… |
| A0A2P5KTU8 | 460-589 | FIERARVHADALMSERGEVLGTVISHDLVRLVRSATSSERLEFLSMLSKRFAPDPKAISVAADRWRLEPSEANRASLAAAVEAPRQE… |
| A0A1S3JV45 | 37-167 | None |
| A0A5N5MZM2 | 67-196 | None |
| A7T5Q1 | 30-171 | None |
| A0A162ULQ6 | 79-224 | None |
| A0A446U9B5 | 19-176 | None |
| A8TKZ1 | 4-131 | None |
| A0A2B4RZ80 | 48-200 | None |
| A0A2Y9P609 | 37-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.