DPCstruct | MC23112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 374 ± 84 aa |
| Standard deviation of domain lengths | 83.88 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 69.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.80 |
| Pfam Score | 95.87 |
| Assigned Pfam label(s) | PF12230- PF01805 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0FAZ4 | 23-213 | VTVPTISAQDIAIVKLTAQFVAKNGKGFLQSLMQREVRNYHFDFLKPHHSLFFYFTKLVEQYTKVMLPPKGTKEVLQKDGKSPYNAL… |
| A0A642UC73 | 62-361 | SKPSSDSGAKPEIKQAPPELHFITPLPTISTRDYEVVKLVAKYTAVNGDEYATKLQEHYKNDPIYDFIREEHHFHKLFRRLVDQYRR… |
| A0A3M7A560 | 2-338 | None |
| A0A364N1T2 | 100-504 | None |
| A0A3Q0KK75 | 83-561 | None |
| A0A1G4MGV4 | 19-399 | None |
| A0A7S1KL36 | 1-519 | None |
| A0A1Y1WKL6 | 9-471 | None |
| A0A3M9YKF0 | 485-957 | None |
| A0A553N9W3 | 72-456 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.