DPCstruct | MC2311
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 78 ± 7 aa |
| Standard deviation of domain lengths | 6.55 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 54.78 |
| Pfam Score | 65.00 |
| Assigned Pfam label(s) | PF00032- CL0328 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A425WQM4 | 10-97 | LLPFILAALVILHLIALHVHGSSNPIGITGNMDRLSMHPYFIFKDAITIFVFLILFCFFVFFSPNTLGHPDNYIPGNPLVTPASIVPE |
| A0A078SSS7 | 2-77 | HLIAKEENGSSNPLGITANADMIYMHPYYIFKDLVTIFLFFLVLGLFLFYAPNKLGHPDNYIPANPMQTPASIVPE |
| A0A0L6W729 | 146-221 | None |
| A0A6J1FGM4 | 181-257 | None |
| A0A6A6AW58 | 2-70 | None |
| A0A484MNN4 | 39-134 | None |
| A0A212CAV9 | 62-138 | None |
| A0A2X0P0T8 | 1-77 | None |
| A0A0S7J851 | 86-159 | None |
| A0A4Q5NG07 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.