DPCstruct | MC23109
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Standard deviation of domain lengths | 8.32 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 52.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13340 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U4QN97 | 111-174 | IDPYDIFCATLYVLKNGCTWRDLPADYPKWSTVYYYWMSWSKAPTPDKPALLTQVLKKLSLIDD |
| A0A809N3D7 | 1-75 | MDLFDVFNAVLYELRTGAQWRQLPHDFPKWQTVYTYFAMWSKPLANSEYSLIDLLLKKLSLESDYEWDDRYERRS |
| A0A3E1DN66 | 74-159 | None |
| A0A381E972 | 32-101 | None |
| A0A1G2D4W8 | 33-111 | None |
| A0A381EEE2 | 98-160 | None |
| A0A4Y9SE51 | 26-97 | None |
| A0A839ZM23 | 36-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.