DPCstruct | MC23108
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 324 ± 55 aa |
| Standard deviation of domain lengths | 54.92 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 14.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A410Q4Y5 | 10-386 | GMAKKVQIVSNNICYGPCPQPGDEVEQHLSITTDGRVFFSSYAYGNGDKYIKSRSKNFKIDAAKAAYILKMVGSYFSNEYDVSFVTD… |
| A0A0R1K1W8 | 3-307 | QTLTIKLPKAVTLVNHFGSGHTTTQTIAVSSERLQKILPVLTTLADDIDQVPLATDVGTWRITIKGAGGQATAQGSLLLGGDTELSE… |
| A0A7X6HUX5 | 119-575 | None |
| A0A0R1WGQ9 | 14-283 | None |
| A0A349REZ9 | 40-327 | None |
| A0A7V8A775 | 52-429 | None |
| A0A1G4QFJ9 | 223-493 | None |
| A0A1G5WNQ4 | 3-327 | None |
| A0A7W6NRQ6 | 23-255 | None |
| A0A1M6HLT2 | 99-478 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.