DPCstruct | MC23105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 80 ± 13 aa |
| Standard deviation of domain lengths | 12.89 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12623 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z4IA44 | 1-70 | MLLTITTTHSPATELGYLLHKHPDRFHSFSLSYGKAHVFYPEANDERCTAALLLDVDPVKLVRGRGATLA |
| A0A4R6Z6N0 | 1-81 | MLLTLSTTHQPATDLGYLLAKHPDRLQRFGLSFGQACVFYSEASAQRCTAVLMLDIDPVGLVHGNGENSAGPLARAPVRPV |
| A0A0B8NBG1 | 1-80 | None |
| A0A229TAV2 | 214-281 | None |
| A0A4R2JMZ3 | 1-72 | None |
| A0A1I2ZX66 | 1-94 | None |
| A0A2T4DU27 | 1-107 | None |
| A0A1C6QC08 | 49-158 | None |
| A0A3A9VT57 | 1-76 | None |
| A0A7X0D3B3 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.