DPCstruct | MC23103
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 219 ± 24 aa |
| Standard deviation of domain lengths | 23.69 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M9EPP0 | 232-458 | MTKRSHMGNLQFFHGMGSELGEKPEKTKKNILTWIEVMYKLACGNQGVSEDDVLNDALHGYFGKETVPSKSDTLRDLLLATTPKYNK… |
| A0A4R6YNP4 | 11-226 | LEQAAGSARSHYGDLQFMHAMAAYEGEPAGATQHNMRIWAQFLWGVASGAIATDINLREVDVPGFAGFFPGEMTATNLFATGIVEAR… |
| A0A423FXL2 | 17-235 | None |
| M3GWQ2 | 537-725 | None |
| A0A4T1ZWB7 | 8-186 | None |
| A0A2S3VQV9 | 34-258 | None |
| A0A844ZSH2 | 96-322 | None |
| T0JNK3 | 90-319 | None |
| A0A0N0D2H1 | 366-554 | None |
| F9WXG5 | 115-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.