DPCstruct | MC231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 134 ± 17 aa |
| Standard deviation of domain lengths | 16.57 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 42.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833VY84 | 1-124 | MLHEGCLKHRESVITSDFGRTGDKDSQVGRFQRDDKNLRQKLEKCPDVEIYLPSSIRGDGYCEDAMGYVKYLQGRALPRWVLDVEFE… |
| T0QTN5 | 64-192 | RNETQGDDLFGDIVHLNNLNEACFHANDSIVHWAFNSSEVNHTELWTRDATPRDELIAHLAQCPEVDVFLPAGLRDHGYCEDGMAYV… |
| A0A6A3KXA5 | 49-171 | None |
| A0A3F2RLZ2 | 283-443 | None |
| A0A067BUA3 | 74-196 | None |
| A0A833SU12 | 38-200 | None |
| A0A3R7BNQ1 | 29-157 | None |
| A0A3L6UNX2 | 36-176 | None |
| A0A418ECS6 | 13-157 | None |
| A0A418C0B9 | 43-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.