DPCstruct | MC23098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 148 ± 18 aa |
| Standard deviation of domain lengths | 17.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 69.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A166D4R6 | 1-121 | MPKQAYRDKGKDKVLEHFSFNENGVFAQKAVRIMDEGKLSRFSPAFGSSVVNMNAAVGKEIYARDILHHAILGTLKAVIPKLYVSNP… |
| A0A175YMX2 | 1-152 | MVPPVAPKVLANLDGNSPGGSNSLAVVNEGKMKCKGKMFQGYAFNDNGFISSKAVGILNSGCLSSFAPTFANEVVNLEAPVGKGLFA… |
| A0A175YLZ9 | 49-205 | None |
| A0A164WUW1 | 97-244 | None |
| A0A164VVV9 | 142-313 | None |
| A0A175YAJ8 | 128-257 | None |
| A0A166FRU9 | 152-285 | None |
| A0A166F8F2 | 146-325 | None |
| A0A164SWT0 | 32-152 | None |
| A0A162AVY5 | 114-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.