DPCstruct | MC23097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 104 ± 11 aa |
| Standard deviation of domain lengths | 11.45 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 66.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4CKM9 | 1-90 | MNHQNTYFGNSTMSPESSGMNHLSGTATNWSSEEQAILEDALVRYSSDPSPSISRYAKIASELHHKTVRDVALRCRWINESIDKVVA… |
| A0A175YMD6 | 2-92 | ANPYNEPGRPVNGNSRQQESTPVLQHSSGISMEWTPEEQAILEDNLARYGSETNIVRYAKIAVLLHNKTVRDVALRCRWMNKKENSK… |
| C0P366 | 30-155 | None |
| A0A3L6PYA5 | 20-123 | None |
| A0A834Z2Y7 | 45-145 | None |
| A0A3P6FXH8 | 7-115 | None |
| A0A0K9R3W5 | 39-158 | None |
| A0A2U1PZZ0 | 1-98 | None |
| A0A2R6P6L3 | 68-163 | None |
| A0A7J8QLE6 | 22-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.