DPCstruct | MC23095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 102 ± 8 aa |
| Standard deviation of domain lengths | 8.09 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7LZN3 | 73-171 | EIYAKGVEAIPLSIDLWTAYLDATMEIVHGQEDYETRMRNLYELALEKAGMEFRSDALWEHYISWESGHNRLQRALAIYDRILKTPT… |
| A0A166JCW8 | 1-109 | MIEADHEERMGSTDKDIKVYEWAVQKVTYSVDMWLHYCVFAINTYGDLDTIKRLFGRGLVYVGSDFLSYTMWDKYIEYEYTHQEWSR… |
| A0A446KVQ2 | 99-198 | None |
| A0A183HJ22 | 103-197 | None |
| A0A453BDL6 | 57-150 | None |
| A0A6A2WJE4 | 46-172 | None |
| A0A7J7KKA1 | 1-111 | None |
| A0A0B2W0B0 | 142-236 | None |
| A0A0S7GK19 | 2-105 | None |
| A0A183NLT5 | 2-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.