DPCstruct | MC23091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 143 ± 28 aa |
| Standard deviation of domain lengths | 28.39 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 42.25 |
| Pfam Score | 98.25 |
| Assigned Pfam label(s) | CL0063- PF04043- CL0588 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S7MVL1 | 3-120 | RKMKLPGREGKTAVVVGTITDDVRIQEVPKLKVCALRVSSRARSRILKAGGKILTFDQLALDSPKGCGTVLLSGPRKAREVYRHFGK… |
| A0A2K5CLN6 | 1-141 | MGVDIRHYQDRKDIYLRLLVKLTNYTFTQIVLKMLFMSCTNRPPLSLSRMIQKMKLPRRENKTAMVVGTITDDVRIQEVPKLKVCAL… |
| A0A821HTB2 | 8-176 | None |
| A0A0D3CMJ2 | 30-210 | None |
| A0A1R3K845 | 949-1121 | None |
| R9PFR9 | 157-312 | None |
| A0A1V6NZK7 | 353-522 | None |
| A0A445CE28 | 18-141 | None |
| A0A2I0I861 | 9-135 | None |
| A0A6A3B0U2 | 98-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.