DPCstruct | MC2309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 253 ± 50 aa |
| Standard deviation of domain lengths | 50.23 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q1T9X6 | 27-259 | EQLRQATQPMIKFAEAMNVQMHALNLKDIADAIEETESDIKKFKLIMVEIGYPPHDEIEIPQARYIVRFYEEHGLEKTRGLVEDYLV… |
| Q1QLK9 | 54-255 | DDIMNHVSGFTRTLHYFCRDNGFYLFGVLTVEMLIGIDNALKNDVLTKILIFDLFKSATKRDAVVKLVEDACDTFDSFGPRRKILLD… |
| F1T7Z2 | 52-308 | None |
| A0A1S2I4U1 | 3-330 | None |
| A0A4Q3ND48 | 2-157 | None |
| A0A5P6FTJ9 | 73-341 | None |
| A0A6M5FAH6 | 1-360 | None |
| A0A7T9NEK3 | 15-277 | None |
| A0A421BE83 | 3-241 | None |
| A0A0F8IZM8 | 1-399 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.