DPCstruct | MC23088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 132 ± 23 aa |
| Standard deviation of domain lengths | 23.24 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 28.23 |
| Pfam Score | 98.53 |
| Assigned Pfam label(s) | PF20174- PF01894 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5S2G0 | 5-109 | TKYLEFNTSTHREYVDITEEVRDILGDSGVREGLLLVSAMHITAGVFINDAEDGFLADLDAFLENLAPFRKDYRHHRTGETNGDSHL… |
| I3ICW9 | 5-120 | KEYQLKARARGFHLITEEIIQQLPELKQVKVGLLNILIKHTSASLTINENADPTVRKDFESFFNRAVAEDEPYYLHRDEGGDDMPAH… |
| A0A6S7I816 | 23-120 | None |
| A0A819XXZ0 | 272-376 | None |
| A0A318YN56 | 475-611 | None |
| A0A7C3RM15 | 23-171 | None |
| A0A817PAY8 | 2-94 | None |
| A0A662V665 | 2-97 | None |
| A0A654H8S1 | 493-640 | None |
| A0A218Z4R2 | 883-1026 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.