DPCstruct | MC23085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 109 ± 8 aa |
| Standard deviation of domain lengths | 7.72 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 24.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D7KVF7 | 1-121 | MRCSGEFSSGDVFFCFSITYRRPPFNVPQYSEYQFFLYQTITEQRETGNTFDQIAEWLNKKGYLSVRGKKFKGNHVHSIVKKKRLKD… |
| A0A2E7WFK5 | 1-100 | MCGVIIPRFVLHLDVEITTNALTLWGIFGRRKEIHDMIMELHDQGYLDKDIAEILNDRNILTPRNRVWFGKNVWAARDYIRKRQERE… |
| A0A2E1TE93 | 19-125 | None |
| A0A7Z9G8Q8 | 37-147 | None |
| A0A1Z9LX29 | 1-120 | None |
| A0A836PL30 | 1-105 | None |
| A0A2M6V1L9 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.