DPCstruct | MC23083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 166 ± 25 aa |
| Standard deviation of domain lengths | 24.56 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.37 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF11874- CL0182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381XYE7 | 13-148 | AALMAQVVVEVGNASGYIFPLIAIHMYVFYYGLMADVTPPVGLASYAAAAISRADPIKTGIQAFWYSLRTGILPIVFIFNNELLLIG… |
| A0A2D4VYC4 | 11-181 | ALLLGPVLAGLGISTFTAHMFIFYFAVASAITPPVALAAFAASSITKAEPMATGFSAVKSGIVIFIVPFIFAMYPEILLISDAVLDA… |
| A0A355B0M5 | 402-588 | None |
| A0A7G2M3Q3 | 207-380 | None |
| A0A0B8PDV3 | 4-144 | None |
| A0A7D7ZLM9 | 119-301 | None |
| A0A7C6ZH52 | 451-623 | None |
| A0A2E9Y4U8 | 444-626 | None |
| A0A6N7G1C6 | 2-154 | None |
| A0A212DKG7 | 2-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.